PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G30480.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 395aa    MW: 40138.7 Da    PI: 9.4484
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G30480.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.5e-3990151263
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                      kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  ONIVA02G30480.2  90 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 151
                      7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3186148IPR003851Zinc finger, Dof-type
PfamPF027012.7E-3392148IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05994148IPR003851Zinc finger, Dof-type
PROSITE patternPS01361096132IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MANLLFFVQI YARIGHILLA LCGLGLVKPM EEMLMGANPN PNGSSNQPPP PPSSAASAQR  60
PIAPPAAGAA AGAGAAGAGA GTERRARPQK EKALNCPRCN STNTKFCYYN NYSLQQPRYF  120
CKTCRRYWTE GGSLRNVPVG GGSRKNKRSS SSVVPSAAAS ASTSAAVSGS VPVGLAAKNP  180
KLMHEGAQDL NLAFPHHHGR ALQPSEFTAF PSLESSSVCN PGGNLAAANG AGGRGSVGAF  240
SAMELLRSTG RTSTWRSLTT TGMPAEYAAA GFHLGEFRMP PPPQQQQQQQ AQTVLGFSLD  300
THGAGAGGGS GVFGACSAGL QESAAGRLLF PFEDLKPVVS AAAGDANSGG DHQYDHGKNQ  360
GGGGGVIGGH EAPGFWNSSM IGNGSSNGGG GGGSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627550.11e-162PREDICTED: dof zinc finger protein DOF4.6 isoform X1
TrEMBLA0A0E0GB720.0A0A0E0GB72_ORYNI; Uncharacterized protein
STRINGBGIOSGA005855-PA1e-163(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.14e-43Dof family protein